Event snippet :

Product Catalogue

HIV-1-p24 MAb BC 1071

SKU BC1071
€0.00
In stock
1
Product Details
Data Sheet
PRODUCT CODE
BC1071
CLONE NO. EH12E1*
IMMUNOGEN HIV-1 (CBL-1) isolate*
FORM Presented as Protein G affinity purified immunoglobulin in phosphate buffered saline (PBS), pH 7.2. Contains 0.09% sodium azide as preservative. Product has undergone a final 0.2 micron filtration.
ANTIBODY CONCENTRATION 1.0 mg/ml (E0.1% = 1.36)

280nm

IMMUNOGLOBULIN SUBCLASS IgG1*
PURITY >95% IgG content, assessed by visual evaluation on “Phast” SDS-PAGE (non-reduced).
SPECIFICITY Mapped to a complex epitope incorporating 2 distinct peptide sequences**. These are GHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQ (aa 193-227) and NPPIPVGEIYKRWII (aa 253-267). These regions of p24 are conserved between HIV-1 strains, and also substantially between HIV-1 and HIV-2. The specific reactivity with the structural p24 gag protein of HIV-1 was demonstrated by the Western Blot technique.
PACKAGING 0.1mg/0.5mg vial
STORAGE +2 to +8°C
For research purposes only.


References : * Ferns R.B., Tedder R.S., and Weiss R.A. J. Gen. Virol (1987), 68, 1543-1551 ** Ferns R.B., Partridge J.C., Spence R.P., Hunt N. and Tedder R.S. (1989) AIDS 3 : 829-834 26/01/94
Save this product for later

Aalto Bio Reagents Ltd,

Church Lane, Rathfarnham Village,

Dublin D14 RK22, Ireland. 


Tel: +353-1-4900685

Fax +353-1-4900122

E-mail: info@aaltobioreagents.com

Web: www.aaltobioreagents.com

  • Follow Aalto Bio Reagents on Twitter
  • slideshare
  • LinkedIn Social Icon

© 2018 Aalto Bio Reagents